DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and CG7130

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster


Alignment Length:149 Identity:34/149 - (22%)
Similarity:58/149 - (38%) Gaps:50/149 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |:|::|.:...||.:::|..|:::.|:.||||     :.:|.:|.|   |..:.||:..|.|..:
  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRYHPDK-----NDHPQAEEQ---FREVVAAFEVLFDKEK 60

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKG 132
            |:.||                       |..:..::.||:.|...:.|.|..             
  Fly    61 REIYD-----------------------QHGEEGLKCDDEPAATFAQPTPDM------------- 89

  Fly   133 PATMWSYAYDCRCGGQYLF 151
                  ..:.|..||..||
  Fly    90 ------LPFMCAVGGTVLF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 21/68 (31%)
zf-CSL <138..179 CDD:398744 5/14 (36%)
CG7130NP_649380.1 DnaJ_bact 4..>73 CDD:274090 24/99 (24%)

Return to query results.
Submit another query.