Sequence 1: | NP_001097689.1 | Gene: | CG2911 / 40686 | FlyBaseID: | FBgn0037350 | Length: | 183 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_958499.1 | Gene: | dnaja3b / 394242 | ZFINID: | ZDB-GENE-040115-3 | Length: | 474 | Species: | Danio rerio |
Alignment Length: | 224 | Identity: | 61/224 - (27%) |
---|---|---|---|
Similarity: | 78/224 - (34%) | Gaps: | 80/224 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
Fly 68 RKHYDA--------------------------ELLQSKF------RAHSNIYA--------TVVL 92
Fly 93 SEMQ-------RIQVEIEED----DDEAPAPSAPPP----CQASESESESEANKGPATMWSYAYD 142
Fly 143 C-RCGGQYLFDGPADDDESPEVIVECNEC 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2911 | NP_001097689.1 | DnaJ | 3..72 | CDD:278647 | 28/68 (41%) |
zf-CSL | <135..179 | CDD:282991 | 9/37 (24%) | ||
dnaja3b | NP_958499.1 | DnaJ | 85..428 | CDD:223560 | 61/224 (27%) |
DnaJ | 86..148 | CDD:278647 | 28/68 (41%) | ||
DnaJ_C | 203..409 | CDD:199909 | 26/100 (26%) | ||
DnaJ_zf | 229..289 | CDD:199908 | 18/74 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |