DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and dnaja3b

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_958499.1 Gene:dnaja3b / 394242 ZFINID:ZDB-GENE-040115-3 Length:474 Species:Danio rerio


Alignment Length:224 Identity:61/224 - (27%)
Similarity:78/224 - (34%) Gaps:80/224 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            ||||:|.||.|||..|||.:|.||..:.||       |.||........|..:..|:.||.|.::
Zfish    86 DFYEVLGVPRTASQKEIKKAYYQLAKKYHP-------DTNPDDPDAKEKFAKLAEAYETLSDELK 143

  Fly    68 RKHYDA--------------------------ELLQSKF------RAHSNIYA--------TVVL 92
            ||.||.                          ||.:..|      |...:|.:        .:.|
Zfish   144 RKQYDTYGSAGPSASGTGQQQYWRGSANVDPEELFRKIFGEFAGGRGFGDINSMFDQAPEFVMEL 208

  Fly    93 SEMQ-------RIQVEIEED----DDEAPAPSAPPP----CQASESESESEANKGPATMWSYAYD 142
            |.||       .|.|.|::|    |.:|..|.....    |..:..||   .|.||..|.|   .
Zfish   209 SFMQAAKGVNKEITVNIDDDCPRCDGKAFEPGTKVSHCHYCNGTGMES---INTGPFMMRS---A 267

  Fly   143 C-RCGGQYLFDGPADDDESPEVIVECNEC 170
            | ||.|:...           :|..|..|
Zfish   268 CRRCSGRGFI-----------IITPCIMC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 28/68 (41%)
zf-CSL <135..179 CDD:282991 9/37 (24%)
dnaja3bNP_958499.1 DnaJ 85..428 CDD:223560 61/224 (27%)
DnaJ 86..148 CDD:278647 28/68 (41%)
DnaJ_C 203..409 CDD:199909 26/100 (26%)
DnaJ_zf 229..289 CDD:199908 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.