DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and dnajc24

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_021326139.1 Gene:dnajc24 / 393424 ZFINID:ZDB-GENE-040426-1153 Length:170 Species:Danio rerio


Alignment Length:153 Identity:38/153 - (24%)
Similarity:63/153 - (41%) Gaps:38/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRKHYDAELLQSKFRAHSNIYATV 90
            ::|:.||||.|. |.....:|.....|..|:.||..|.:...|..|:.:|...:.:....:.|.:
Zfish    54 VLLEFHPDKQRP-DVSEEEAEQHLQRFIDIDQAWKILSNEESRNEYNLQLRACELKQSWPVDAHI 117

  Fly    91 VLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKGPATMWSYAYDCRCGGQYLFDGPA 155
            .|.:|                          ..:.|:|.         |:|.|||||:::.:  .
Zfish   118 TLDDM--------------------------NWDYETEC---------YSYTCRCGGEFILE--K 145

  Fly   156 DDDESPEVIVECNECSLVIIVKQ 178
            |:.:..|.:|.|:.|||.|.||:
Zfish   146 DETQEVETVVCCDSCSLSIEVKK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 14/45 (31%)
zf-CSL <135..179 CDD:282991 17/44 (39%)
dnajc24XP_021326139.1 DnaJ <56..99 CDD:321979 14/43 (33%)
zf-CSL 115..167 CDD:310075 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5412
OMA 1 1.010 - - QHG54729
OrthoDB 1 1.010 - - D1580122at2759
OrthoFinder 1 1.000 - - FOG0005154
OrthoInspector 1 1.000 - - oto41034
orthoMCL 1 0.900 - - OOG6_104505
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R339
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.