powered by:
Protein Alignment CG2911 and dnajc5aa
DIOPT Version :9
Sequence 1: | NP_001097689.1 |
Gene: | CG2911 / 40686 |
FlyBaseID: | FBgn0037350 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002464.1 |
Gene: | dnajc5aa / 386768 |
ZFINID: | ZDB-GENE-031113-20 |
Length: | 202 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 27/68 - (39%) |
Similarity: | 35/68 - (51%) |
Gaps: | 7/68 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRK 69
|.:|.|...|:.|:||.||::|.|:.|||| ||.:......|..||.|...|.||.:|.
Zfish 18 YHVLGVDKVATVDDIKKSYRKLALKYHPDK-------NPDNPEAADKFKEINNAHAILNDPTKRN 75
Fly 70 HYD 72
.||
Zfish 76 IYD 78
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2911 | NP_001097689.1 |
DnaJ |
3..72 |
CDD:278647 |
25/66 (38%) |
zf-CSL |
<135..179 |
CDD:282991 |
|
dnajc5aa | NP_001002464.1 |
DnaJ |
16..>85 |
CDD:223560 |
27/68 (40%) |
DnaJ |
16..78 |
CDD:278647 |
25/66 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.