DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and dnajb11

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_942116.1 Gene:dnajb11 / 386709 ZFINID:ZDB-GENE-031113-9 Length:360 Species:Danio rerio


Alignment Length:207 Identity:55/207 - (26%)
Similarity:87/207 - (42%) Gaps:58/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |||::|.|..:||..:||.:|::|.||.|||  |..||||    ||:. |..:.||:..|.|..:
Zfish    27 DFYKILGVSRSASVKDIKKAYRKLALQLHPD--RNQDDPN----AQDK-FADLGAAYEVLSDEEK 84

  Fly    68 RKHYDA----ELLQSKFRAHSNIYAT-------------------------VVLSEMQRIQVEIE 103
            ||.|||    .|.:....:|.:|:::                         :||.    ::|.:|
Zfish    85 RKQYDAYGEEGLKEGHQSSHGDIFSSFFGDFGFMFGGSRQPAGRDIPRGNDIVLD----LEVTLE 145

  Fly   104 E--DDDEAPAPSAPPPCQASESESESEANKGPATMWSYAYDCRCGGQYLFDGPADDDESPEVIVE 166
            |  ..:........|  .|.|:..:.:.|            ||...:....||.....:.||:  
Zfish   146 EVYSGNFVEVVRIKP--VAKEAPGKRKCN------------CRQEMRTTQLGPGRFQMTQEVV-- 194

  Fly   167 CNECSLVIIVKQ 178
            |:||..:.:|.:
Zfish   195 CDECPNIKLVNE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 30/68 (44%)
zf-CSL <135..179 CDD:282991 10/44 (23%)
dnajb11NP_942116.1 DnaJ 24..346 CDD:223560 55/207 (27%)
DnaJ 27..89 CDD:278647 30/68 (44%)
DnaJ_C 134..331 CDD:199909 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.