Sequence 1: | NP_001097689.1 | Gene: | CG2911 / 40686 | FlyBaseID: | FBgn0037350 | Length: | 183 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_942116.1 | Gene: | dnajb11 / 386709 | ZFINID: | ZDB-GENE-031113-9 | Length: | 360 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 87/207 - (42%) | Gaps: | 58/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
Fly 68 RKHYDA----ELLQSKFRAHSNIYAT-------------------------VVLSEMQRIQVEIE 103
Fly 104 E--DDDEAPAPSAPPPCQASESESESEANKGPATMWSYAYDCRCGGQYLFDGPADDDESPEVIVE 166
Fly 167 CNECSLVIIVKQ 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2911 | NP_001097689.1 | DnaJ | 3..72 | CDD:278647 | 30/68 (44%) |
zf-CSL | <135..179 | CDD:282991 | 10/44 (23%) | ||
dnajb11 | NP_942116.1 | DnaJ | 24..346 | CDD:223560 | 55/207 (27%) |
DnaJ | 27..89 | CDD:278647 | 30/68 (44%) | ||
DnaJ_C | 134..331 | CDD:199909 | 19/93 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0713 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |