DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and Dnajc24

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:173 Identity:46/173 - (26%)
Similarity:71/173 - (41%) Gaps:41/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |:|.:|....:|...::|..|::|||..|||| :..|.|....|.....|..|:.||..|.:...
  Rat    10 DWYSILGADPSADVSDLKQKYQKLILLYHPDK-QSADVPAGTMEECVQKFIEIDQAWKILGNEET 73

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKG 132
            :|.||.:..:.:.|....:.|.|.|.||.      ...|:|                        
  Rat    74 KKKYDLQRHEDELRNVGPVDAQVHLEEMS------WNKDEE------------------------ 108

  Fly   133 PATMWSYAYDCRCGGQYLFDGPADDDESPEV-IVECNECSLVI 174
                 |::..|||||:|    ....||:.|. ::.|:.|||::
  Rat   109 -----SFSLSCRCGGKY----TVYKDEAQEANLISCDTCSLIV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 22/68 (32%)
zf-CSL <135..179 CDD:282991 14/41 (34%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 22/68 (32%)
zf-CSL 94..147 CDD:398744 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5339
OMA 1 1.010 - - QHG54729
OrthoDB 1 1.010 - - D1580122at2759
OrthoFinder 1 1.000 - - FOG0005154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104505
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.