DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and Dnajb11

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001015021.1 Gene:Dnajb11 / 360734 RGDID:1307373 Length:358 Species:Rattus norvegicus


Alignment Length:199 Identity:55/199 - (27%)
Similarity:81/199 - (40%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |||::|.||.:||..:||.:|::|.||.|||  |..|||    :||.. |..:.||:..|.|..:
  Rat    25 DFYKILGVPRSASIKDIKKAYRKLALQLHPD--RNPDDP----QAQEK-FQDLGAAYEVLSDSEK 82

  Fly    68 RKHYDA----ELLQSKFRAHSNIYATVV-----------------LSEMQRIQVEIEEDDDEAPA 111
            ||.||.    .|......:|.:|::...                 :.....|.|::|...:|..|
  Rat    83 RKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGAPRQQDRNIPRGSDIIVDLEVTLEEVYA 147

  Fly   112 PSAPPPCQASESESESEANKGPATMWSYAYDCRCGGQYLFD--GPADDDESPEVIVECNECSLVI 174
            .:.          .|...||..|........|.|..:....  ||.....:.||:  |:||..|.
  Rat   148 GNF----------VEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVV--CDECPNVK 200

  Fly   175 IVKQ 178
            :|.:
  Rat   201 LVNE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 30/68 (44%)
zf-CSL <135..179 CDD:282991 11/46 (24%)
Dnajb11NP_001015021.1 DnaJ 22..344 CDD:223560 55/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.