DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and DNAJB1

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens


Alignment Length:70 Identity:25/70 - (35%)
Similarity:42/70 - (60%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |:|:.|.:...||.:|||.:|::..|:.||||.::     ||:|.:   |..|..|::.|.||.:
Human     4 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKE-----PGAEEK---FKEIAEAYDVLSDPRK 60

  Fly    68 RKHYD 72
            |:.:|
Human    61 REIFD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 24/68 (35%)
zf-CSL <138..179 CDD:398744
DNAJB1NP_006136.1 DnaJ_bact 4..336 CDD:274090 25/70 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.