powered by:
Protein Alignment CG2911 and shv
DIOPT Version :9
Sequence 1: | NP_001097689.1 |
Gene: | CG2911 / 40686 |
FlyBaseID: | FBgn0037350 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608525.1 |
Gene: | shv / 33220 |
FlyBaseID: | FBgn0031256 |
Length: | 354 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 27/70 - (38%) |
Similarity: | 44/70 - (62%) |
Gaps: | 7/70 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
|||::|||...|:.:|:|.:|::|..:.||||.: |||:..:: |..:.||:..|.:|.:
Fly 25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNK--DDPDASTK-----FQDLGAAYEVLSNPDK 82
Fly 68 RKHYD 72
||.||
Fly 83 RKTYD 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0713 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.