DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and dph4

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_594366.1 Gene:dph4 / 2543534 PomBaseID:SPAC926.05c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:46/176 - (26%)
Similarity:70/176 - (39%) Gaps:53/176 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELLNVP--STASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |.:||:.  .|.:.||||.:|::.:|..||||.::       ..:.....:.:..|:..|.....
pombe     4 YSVLNLKDGKTYTDDEIKEAYRKALLLFHPDKCKE-------KPSVVYTIDQVKEAYQVLSSEKD 61

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKG 132
            |:.|  ::.|.:..:|  .|:.|.|||.:                               |.:.|
pombe    62 RQQY--QIKQEEESSH--YYSIVDLSEFE-------------------------------ELDNG 91

  Fly   133 PATMWSYAYDCRCG--GQYLFDGPADDDESPEVIVECNECSLVIIV 176
                 ||.|.||||  |.|:.  ..||.|:...:|.|..|||.|.|
pombe    92 -----SYYYPCRCGDLGGYVV--TEDDLENNRSVVPCMGCSLTIQV 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 17/68 (25%)
zf-CSL <135..179 CDD:282991 19/44 (43%)
dph4NP_594366.1 CbpA 1..>139 CDD:225124 46/176 (26%)
DnaJ 2..65 CDD:278647 17/67 (25%)
zf-CSL 78..133 CDD:282991 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54729
OrthoFinder 1 1.000 - - FOG0005154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104505
Panther 1 1.100 - - LDO PTHR21454
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R339
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.910

Return to query results.
Submit another query.