DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and Dnajc5g

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_011239025.1 Gene:Dnajc5g / 231098 MGIID:3045263 Length:177 Species:Mus musculus


Alignment Length:159 Identity:38/159 - (23%)
Similarity:61/159 - (38%) Gaps:45/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRK 69
            |.:|.:...|...:||.:|::|.||.||||       ||.:......|..||.|...|.||.::|
Mouse    19 YAVLELKKGAETADIKKAYRKLALQYHPDK-------NPDNPLAAEIFKEINTAHAILTDPTKKK 76

  Fly    70 --------------HYDAELLQSKFRAHSNIYATVVL---------------SEMQRIQVEIEED 105
                          |:..|.::..|..:|..:.|:|:               ....|:....||:
Mouse    77 IYDRHGSLGLYLYDHFGEEGVRFYFIVNSCWFKTLVILCCLLTGCCCCCCCCLCCGRLNPSAEEE 141

  Fly   106 DDEAPAPSAPPPCQASESESESEANKGPA 134
            ::..         |.:.|...|.::.|||
Mouse   142 EENR---------QMNVSSQPSRSSAGPA 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 24/80 (30%)
zf-CSL <135..179 CDD:282991 38/159 (24%)
Dnajc5gXP_011239025.1 DnaJ 16..>86 CDD:223560 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.