DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and Dnajc16

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_758841.1 Gene:Dnajc16 / 214063 MGIID:2442146 Length:772 Species:Mus musculus


Alignment Length:98 Identity:31/98 - (31%)
Similarity:48/98 - (48%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |.|.:|.|..|||..:||.:||:|..:.||||     :.:||:|.:   |..|:.|:..|.:..:
Mouse    29 DPYRVLGVSRTASQADIKKAYKKLAREWHPDK-----NKDPGAEDR---FIQISKAYEILSNEEK 85

  Fly    68 RKHYD------------AELLQSKFR-AHSNIY 87
            |.:||            .:..:.:|| .|.|.|
Mouse    86 RTNYDHYGDAGENQGYQKQQREHRFRHFHENFY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 24/68 (35%)
zf-CSL <135..179 CDD:282991
Dnajc16NP_758841.1 DnaJ 29..>135 CDD:223560 31/98 (32%)
TRX_DnaJ 134..243 CDD:239261
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.