DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and dnj-8

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001040753.1 Gene:dnj-8 / 174093 WormBaseID:WBGene00001026 Length:813 Species:Caenorhabditis elegans


Alignment Length:130 Identity:35/130 - (26%)
Similarity:54/130 - (41%) Gaps:30/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |.|::|.:...||..|||.:||.|..:.||||.:        .||.:..|..|..|:..|.||:|
 Worm    22 DPYKVLGISRRASAKEIKSAYKSLAREWHPDKRK--------DEAASGRFMEIAEAYEVLSDPLR 78

  Fly    68 RKHYD--------------AELLQS--------KFRAHSNIYATVVLSEMQRIQVEIEEDDDEAP 110
            ::.||              ||..:|        .|....:::........|:.|.:|.|:.:..|
 Worm    79 KERYDRFGTFDDVKQFEDNAERARSFYGFGGFGGFGFDESVFEYKYRMSYQQYQFKILEESNTKP 143

  Fly   111  110
             Worm   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 24/68 (35%)
zf-CSL <135..179 CDD:282991
dnj-8NP_001040753.1 DnaJ_bact 22..>86 CDD:274090 26/71 (37%)
TRX_DnaJ 118..229 CDD:239261 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.