powered by:
Protein Alignment CG2911 and DNAJB8
DIOPT Version :9
Sequence 1: | NP_001097689.1 |
Gene: | CG2911 / 40686 |
FlyBaseID: | FBgn0037350 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_699161.1 |
Gene: | DNAJB8 / 165721 |
HGNCID: | 23699 |
Length: | 232 |
Species: | Homo sapiens |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 44/72 - (61%) |
Gaps: | 6/72 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPDFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDP 65
|.::||:|.|.::||.::||.:|::|.|:.|||| :|:...||:.. |..::.|:..|.|.
Human 1 MANYYEVLGVQASASPEDIKKAYRKLALRWHPDK-----NPDNKEEAEKK-FKLVSEAYEVLSDS 59
Fly 66 IRRKHYD 72
.:|..||
Human 60 KKRSLYD 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2911 | NP_001097689.1 |
DnaJ |
3..72 |
CDD:278647 |
23/68 (34%) |
zf-CSL |
<135..179 |
CDD:282991 |
|
DNAJB8 | NP_699161.1 |
DnaJ |
3..>106 |
CDD:223560 |
25/70 (36%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.