DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and LOC1273576

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_312569.6 Gene:LOC1273576 / 1273576 VectorBaseID:AGAMI1_004602 Length:1077 Species:Anopheles gambiae


Alignment Length:107 Identity:28/107 - (26%)
Similarity:49/107 - (45%) Gaps:15/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |.|.:|.|....|.::|:..||::.:..||||.:|     ||:|   ..|..:..::..:.:|..
Mosquito   818 DAYSILGVSPDCSQEQIRKHYKKIAVLVHPDKNKQ-----PGAE---EAFKVLQRSFELIGEPES 874

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEA 109
            ||.||..|.::       :.|....||:..:..::.....||
Mosquito   875 RKEYDQSLAEA-------LNAEKAWSEINDLLTQLHTKISEA 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 20/68 (29%)
zf-CSL <138..179 CDD:398744
LOC1273576XP_312569.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.