powered by:
Protein Alignment CG2911 and dnajb9
DIOPT Version :9
Sequence 1: | NP_001097689.1 |
Gene: | CG2911 / 40686 |
FlyBaseID: | FBgn0037350 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001116196.1 |
Gene: | dnajb9 / 100038131 |
XenbaseID: | XB-GENE-493656 |
Length: | 221 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 26/69 - (37%) |
Similarity: | 41/69 - (59%) |
Gaps: | 8/69 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRR 68
:|::|.||..||..:||.::.:|.::.|||| :.:|.:||: |..|..|:.||.|..:|
Frog 27 YYDILGVPKNASERQIKKAFHKLAMKYHPDK-----NKSPDAEAK---FREIAEAYETLSDESKR 83
Fly 69 KHYD 72
|.||
Frog 84 KEYD 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2911 | NP_001097689.1 |
DnaJ |
3..72 |
CDD:278647 |
24/67 (36%) |
zf-CSL |
<135..179 |
CDD:282991 |
|
dnajb9 | NP_001116196.1 |
DnaJ |
23..>193 |
CDD:223560 |
26/69 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.