DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spec2 and cdc42se2

DIOPT Version :10

Sequence 1:NP_730968.1 Gene:Spec2 / 40685 FlyBaseID:FBgn0044823 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001153307.1 Gene:cdc42se2 / 794234 ZFINID:ZDB-GENE-080204-45 Length:85 Species:Danio rerio


Alignment Length:77 Identity:42/77 - (54%)
Similarity:50/77 - (64%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIWLQWFSCCFQQQRSPSRRPHQRLRIDRSMIGNPTNFVHTGHIGSADVELSANRLNAISTQMQS 70
            |.|| .|:||..:|..|.|    |.||||||||.|||||||.|:||.|:....|.:|:|..||||
Zfish     3 EFWL-CFNCCIAEQPQPKR----RRRIDRSMIGEPTNFVHTAHVGSGDLFTGMNSVNSIQNQMQS 62

  Fly    71 KGGY--ETNSIH 80
            ||||  |..|::
Zfish    63 KGGYGGEAMSVN 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spec2NP_730968.1 CRIB 35..75 CDD:238077 26/41 (63%)
cdc42se2NP_001153307.1 CRIB 27..67 CDD:238077 25/39 (64%)

Return to query results.
Submit another query.