DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spec2 and Cdc42se2

DIOPT Version :10

Sequence 1:NP_730968.1 Gene:Spec2 / 40685 FlyBaseID:FBgn0044823 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_848741.1 Gene:Cdc42se2 / 72729 MGIID:1919979 Length:84 Species:Mus musculus


Alignment Length:69 Identity:39/69 - (56%)
Similarity:46/69 - (66%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIWLQWFSCCFQQQRSPSRRPHQRLRIDRSMIGNPTNFVHTGHIGSADVELSANRLNAISTQMQS 70
            |.|| .|:||..:|..|.|    |.||||||||.|||||||.|:||.|:....|.:::|..||||
Mouse     3 EFWL-CFNCCIAEQPQPKR----RRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQS 62

  Fly    71 KGGY 74
            ||||
Mouse    63 KGGY 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spec2NP_730968.1 CRIB 35..75 CDD:238077 25/40 (63%)
Cdc42se2NP_848741.1 CRIB 27..67 CDD:238077 25/40 (63%)

Return to query results.
Submit another query.