DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spec2 and cdc42se1

DIOPT Version :10

Sequence 1:NP_730968.1 Gene:Spec2 / 40685 FlyBaseID:FBgn0044823 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001025615.1 Gene:cdc42se1 / 595003 XenbaseID:XB-GENE-945193 Length:79 Species:Xenopus tropicalis


Alignment Length:70 Identity:30/70 - (42%)
Similarity:39/70 - (55%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIWLQWFSCCFQQQRSPSRRPHQRLRIDRSMIGNPTNFVHTGHIGSADVELSAN--RLNAISTQM 68
            :.|.: ..||..::..|.::   |.||||||||.|.||||..||||.|:..|..  |...:..||
 Frog     3 DFWHK-LGCCVVEKPQPKKK---RKRIDRSMIGEPMNFVHLTHIGSGDMGASDGLPRAGGVQEQM 63

  Fly    69 QSKGG 73
            :||.|
 Frog    64 RSKCG 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spec2NP_730968.1 CRIB 35..75 CDD:238077 21/41 (51%)
cdc42se1NP_001025615.1 CRIB 29..>56 CDD:412170 14/26 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..79 12/28 (43%)

Return to query results.
Submit another query.