DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asl and dnc-3

DIOPT Version :9

Sequence 1:NP_649557.2 Gene:asl / 40682 FlyBaseID:FBgn0261004 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_494573.2 Gene:dnc-3 / 189346 WormBaseID:WBGene00021149 Length:171 Species:Caenorhabditis elegans


Alignment Length:182 Identity:44/182 - (24%)
Similarity:86/182 - (47%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 IVDLKARIAYLEQTVASLHERLNETTTELDLIDSVIQQHQADESPTSRLSQMGGSRLVGSTPLNP 377
            :::|:.:|:.:|:.:.     :::.||:..:...:       |:..|:|.....:.|:.|.|:..
 Worm     3 MIELEKKISEIEEVLG-----IDDLTTKTSIPSQI-------EALQSKLRDDCKANLLMSIPIQK 55

  Fly   378 LDRVGHIKQELYRALGNLKNKREEVRRLEKLLEERNQELRVLRDQENQSLVQLETLNEGKMRLEN 442
            |:.:..|..|.....|:|.:|.|.|:..|||:.||.:.::...|.....|.|         .|.:
 Worm    56 LEHLSKIATETSGPYGSLTDKIESVKYAEKLINERAERIKQFSDALEPCLDQ---------ELFS 111

  Fly   443 KVKAMQQEL--EEQKHRSQQE--SDVHSQLNSIVAERDALREKRQQIEEDLE 490
            ||.|:|.||  |.:|:....|  :..:.:..::||||..:.:|..:...||:
 Worm   112 KVAALQPELDAEIEKYEKALEDWTKTYGEFQTLVAERSMINQKITEKVLDLQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aslNP_649557.2 SMC_prok_B <97..709 CDD:274008 44/182 (24%)
DUF342 <428..503 CDD:302792 18/67 (27%)
GluZincin 484..>629 CDD:301352 2/7 (29%)
dnc-3NP_494573.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.