DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chia.3 and Cht10

DIOPT Version :9

Sequence 1:NP_998378.1 Gene:chia.3 / 406819 ZFINID:ZDB-GENE-040426-2891 Length:471 Species:Danio rerio
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:484 Identity:173/484 - (35%)
Similarity:257/484 - (53%) Gaps:68/484 - (14%)


- Green bases have known domain annotations that are detailed below.


Zfish    22 EMACYFTNWSQYRPGIGKYTPANVDPYLCTHLIYAFSIINQRNELV--TYE-WND--ETLYKAFN 81
            ::.||||||:.||.|||::||.:::..||||:||.|::::. :|||  |:: |.|  ...|....
  Fly   966 KVICYFTNWAWYRKGIGRFTPDDINTELCTHVIYGFAVLDY-SELVLRTHDSWADVENNFYTRVT 1029

Zfish    82 ELKNKNPTLKTLLAVGGWNFGSA-QFSIMVSNPANRKTFIQSTIKFLRTHGFDGLDLDWEYPGA- 144
            .||:|.  :|..||:||||.... ::|.:|.:|..|..|::..::|:..:||:|||||||||.. 
  Fly  1030 SLKSKG--IKVSLALGGWNDSQGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPVCW 1092

Zfish   145 -----RGSPPEDKQRFTLLCKELVAAYEAESKATGNPQLMLTAAVSAGKGTIDDGYEIAEIAKYL 204
                 :|| .|:|..||...:||..|:....       |||:.|||..:..||.||:|.::::|.
  Fly  1093 QTECNKGS-TEEKDGFTAWVQELSEAFRPRG-------LMLSTAVSPSRKIIDAGYDIPQLSRYF 1149

Zfish   205 NFINVMTYDFHGTWERFTGHNSPLYQGSKDEGDLIYFNTDYAMRYWRDNGTPVEKLRMGFAAYGR 269
            ::|.||||||||.|::.|||.:|||....|  |..|||.:|::.||.:.|.|.:||.||...||:
  Fly  1150 DWIAVMTYDFHGHWDKKTGHVAPLYHHPDD--DFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQ 1212

Zfish   270 TFRLTSSDTS-VGAPASGPASAGTYTREAGFWSYYEICGFLEGTTIQWIDDQ---KVPYATKNSE 330
            :|.|.::::| :.|.|..|..||.:||.|||.:|||||..:.....|.:.|:   ..|||.|.::
  Fly  1213 SFTLENTNSSGLNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQVVHDEFGRMGPYAYKGTQ 1277

Zfish   331 WVGFDTKESYETKVRYLKDKNFGGAFVWALDLDDFAGQFCSQGNHPLMAHLRNLLD-----IELP 390
            ||.:|:.:....|...::....||..|||||||||..: |..|.|||:..:.|:|.     :|:|
  Fly  1278 WVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNR-CGNGVHPLLTEIHNVLKDPPSLMEIP 1341

Zfish   391 -PMPSTTTPKPGQS-----------TTRPTTTTTTTTHAPGPGFCNGKPDGLYAHPNDPNKYYSC 443
             |:.:|.|..||..           ..:|......|....|.     :.:|:.    |||     
  Fly  1342 GPIETTPTEYPGMEEEIHESNGEGPEVQPIEAVMQTCENEGE-----EHEGIL----DPN----- 1392

Zfish   444 AGGHTF----VEKCAVGTVFDDSCKCCVW 468
               |..    :|...:.|.|...|....|
  Fly  1393 ---HVLEEENIEATEMATEFKIICYFTNW 1418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chia.3NP_998378.1 Glyco_18 24..363 CDD:214753 142/354 (40%)
GH18_chitolectin_chitotriosidase 25..385 CDD:119351 152/375 (41%)
ChtBD2 421..469 CDD:214696 10/52 (19%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 142/356 (40%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 152/377 (40%)
Glyco_18 1410..1753 CDD:214753 2/9 (22%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 2/8 (25%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6443
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.