DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and SGPL1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_003892.2 Gene:SGPL1 / 8879 HGNCID:10817 Length:568 Species:Homo sapiens


Alignment Length:443 Identity:94/443 - (21%)
Similarity:154/443 - (34%) Gaps:120/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKQRSF----KELLEKRKLPKNGWSDERIEELVHMLASLDSNNYPHKVGLGEREARIACKLVARR 87
            ||..||    ||.:  :.||..|.|...:.|.:...:|:|:         ..:|.|.:       
Human   100 SKNMSFLKVDKEYV--KALPSQGLSSSAVLEKLKEYSSMDA---------FWQEGRAS------- 146

  Fly    88 HYNFGHGIGRSGD--LLEAQPKAAGSTLLARLTNALILDLIRGI----------------GLPSC 134
                  |...||:  |.|...||.|.   ...:|.|..|:..|:                |.|..
Human   147 ------GTVYSGEEKLTELLVKAYGD---FAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDS 202

  Fly   135 AGCFLVPMCTGMTLTLCLQSLRKR--------------RPGARYVLWSRIDQKSCFKAITATGLV 185
            .||    :.:|.|.::.:.....|              .|.:.:..::        ||.:..|:.
Human   203 CGC----VTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFN--------KAASYFGMK 255

  Fly   186 PVVIPCLIKGESLNTNVDLFREKIKSLGVDSILCLYTTTSCFAPRNSDDIAEVSKLSKQWQIPHL 250
            .|.:|..   :.:..:|...|..| |.....::|   :|..|.....|.:.||:||:.:::||..
Human   256 IVRVPLT---KMMEVDVRAMRRAI-SRNTAMLVC---STPQFPHGVIDPVPEVAKLAVKYKIPLH 313

  Fly   251 VNNAYGLQAKEIVNQLECAN---------RVGRIDYFVQSSDKNLLVPVGSAIV-------ASFN 299
            |:...|   ..::..:|.|.         ||..:......:.|....|.||::|       .::.
Human   314 VDACLG---GFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQ 375

  Fly   300 ESVLHD------VASTYAGRASGSQSLDVLMTLLSLGRNGFRLLFDQRGENFNYLRENLRK---- 354
            ..|..|      .:.|.||...|..|......|:..|.||:.....|..:...:|:..|..    
Human   376 FFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGI 440

  Fly   355 --FAEPR-GEIVIDSRFNSISLAITLATLAG---DQMK---SITKLGSMLHMR 398
              |..|: ..|.:.||...|.....|.|..|   :|::   ||....::||.|
Human   441 FVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHAR 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 94/443 (21%)
SGPL1NP_003892.2 DOPA_deC_like 144..507 CDD:99743 80/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.