DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and CG5618

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster


Alignment Length:352 Identity:67/352 - (19%)
Similarity:123/352 - (34%) Gaps:110/352 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LVPVVIPCLIKGESLNTNVDLFREKIKSLGVDSILCLYTTTSCFAPRNSDDIAEVSKLSKQWQIP 248
            :||.:.|..:| |.:|..|   ||               |.:|       .:||:.:|.:| .|.
  Fly    50 IVPFLQPDKLK-ELINLKV---RE---------------TENC-------SLAEIEELCQQ-VIH 87

  Fly   249 HLVNNAYGLQAKEIVNQLECANRVGRI--DYFVQSSDKNLLVPVGSAI----------VASFNES 301
            :.|..::|....::..||:.....|.:  :....|:....:.||.|.|          :|.:.|.
  Fly    88 YSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEG 152

  Fly   302 VLHDVASTYAGRASGSQSLDVLMTLLSL-------GRNGFR--LLFDQRGENFNYLRE----NLR 353
                 ...:|...|.|....:::....:       |..|.|  :||.....::::::.    .|.
  Fly   153 -----DGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLG 212

  Fly   354 KF------AEPRGEIVIDSRFNSISLA-----------ITLATL---AGDQMKSITKL----GSM 394
            .:      ...||::::|.....|:.|           .|..|.   |.|.:.....:    |..
  Fly   213 SYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLW 277

  Fly   395 LHMRGVSGARVIVPGQNKTIDGHEFLDFGSHRSN--LQVPYLTVAA----GIGITRE-------- 445
            ||:....|...::..:|::      |..|..|:|  ...|:.|:.|    .:.:|||        
  Fly   278 LHVDACLGGAALLSAKNRS------LIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERC 336

  Fly   446 ---------EIDKFFDIFNKCWNQIFQ 463
                     :.|||:|:.....|:..|
  Fly   337 NSTEAHYLFQQDKFYDVSYDTGNKSVQ 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 65/344 (19%)
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 49/278 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.