DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and Gad1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001261396.1 Gene:Gad1 / 38484 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster


Alignment Length:108 Identity:23/108 - (21%)
Similarity:44/108 - (40%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SLGVDSILCLYTTTSCFAPRNSDDIAEVSKLSKQWQIPHLVNNAYGLQAKEIVNQLECANRV--- 272
            |:|:...|.::|:..|.....|  .|.|..|...    |.:........|.|.::||   |:   
  Fly   191 SVGLPGTLVMFTSDQCHYSIKS--CAAVCGLGTD----HCIVVPSDEHGKMITSELE---RLILE 246

  Fly   273 ----GRIDYFVQSSDKNLLVPVGSAIVASFNE-SVLHDVASTY 310
                |.|.:||.::       .|:.::.:|:: :.:.|:...|
  Fly   247 RKAKGDIPFFVNAT-------AGTTVLGAFDDINTIADICQKY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 23/108 (21%)
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:395219 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.