DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and GADL1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_997242.2 Gene:GADL1 / 339896 HGNCID:27949 Length:521 Species:Homo sapiens


Alignment Length:282 Identity:52/282 - (18%)
Similarity:94/282 - (33%) Gaps:96/282 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TTTSCFAPRNSDDIAEVSKLSKQWQIPHLVNNAYGLQAKEIVNQLECANRVGRIDYFVQSSDKNL 286
            |....|.|  .|:||::.:....|.  | |:.::|..|.......:..:.:.|.|....:..|.|
Human   276 TVLGAFDP--LDEIADICERHSLWL--H-VDASWGGSALMSRKHRKLLHGIHRADSVAWNPHKML 335

  Fly   287 LVPVGSAIVASFNESVLHDVASTYAGRAS---------------GSQSLD---------VLMTLL 327
            :..:....:...::|.|  :...|:.:||               |.:|:.         ..||..
Human   336 MAGIQCCALLVKDKSDL--LKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWK 398

  Fly   328 SLG------------------------RNGFRLLFDQRGEN--FNYLRENLRKFAE-PRGEIVID 365
            :||                        |.||:||.:....|  |.|:..:||:..| |.    ..
Human   399 ALGTLGLEERVNRALALSRYLVDEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPE----FW 459

  Fly   366 SRFNSISLAITLATLAGDQMKSITKLGSMLHMRGVSGARVIVPGQNKTIDGHEFLDFGSHRSNLQ 430
            ::.|.::.||         .:.:.|.||::                        |.:..||..:.
Human   460 AKLNLVAPAI---------KERMMKKGSLM------------------------LGYQPHRGKVN 491

  Fly   431 VPYLTVAAGIGITREEIDKFFD 452
            . :..|.....::||::|...|
Human   492 F-FRQVVISPQVSREDMDFLLD 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 52/282 (18%)
GADL1NP_997242.2 AAT_I 77..445 CDD:302748 33/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.