DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and GAD1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_000808.2 Gene:GAD1 / 2571 HGNCID:4092 Length:594 Species:Homo sapiens


Alignment Length:217 Identity:48/217 - (22%)
Similarity:83/217 - (38%) Gaps:50/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 NQLECANRVGRIDYFVQ-SSDKNLLVPVGSAIVASFNESVLHDVASTYA-----GRASGSQSLDV 322
            |.||..:|:  :..|.: .|.||||....|...|.|..:.. |.::.:|     .:....|::..
Human    55 NSLEEKSRL--VSAFKERQSSKNLLSCENSDRDARFRRTET-DFSNLFARDLLPAKNGEEQTVQF 116

  Fly   323 LMTLLSLGRNGFRLLFDQRGENFNY-----LRENLRKF-------AEPRGEIVIDSR-------- 367
            |:.::.:..|..|..||:..:..::     |.|.:..|       .|...:|::|.|        
Human   117 LLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR 181

  Fly   368 ------FNSISLAITLATLAGDQMKS----------ITKLGSMLHMRGVSGARVIVPGQNKTIDG 416
                  ||.:|..:.:..|||:.:.|          |..:..::....:...|.||...:|  ||
Human   182 TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSK--DG 244

  Fly   417 HEFLDFGSHRSNLQVPYLTVAA 438
            ......|...||:   |..:||
Human   245 DGIFSPGGAISNM---YSIMAA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 48/217 (22%)
GAD1NP_000808.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Pyridoxal_deC 144..518 CDD:365998 27/125 (22%)
Substrate binding 190..192 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.