DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and Ddc

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001257781.1 Gene:Ddc / 24311 RGDID:2494 Length:480 Species:Rattus norvegicus


Alignment Length:199 Identity:46/199 - (23%)
Similarity:69/199 - (34%) Gaps:59/199 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 YGLQAKEIVNQLECANRVGRIDYFVQSSDKNLLVPVGSAIVASFN-----------ESVLHDVAS 308
            |.::|..:...||.....|.|.:||       :|.:|:....||:           |.|...:.:
  Rat   215 YSMRAAALREALERDKAAGLIPFFV-------VVTLGTTSCCSFDNLLEVGPICNQEGVWLHIDA 272

  Fly   309 TYAGRA----------SGSQSLDVLMTLLSLGRNGFRLL---FD----------QRGENFNYLRE 350
            .|||.|          :|.:..|      |...|..:.|   ||          ...|.||....
  Rat   273 AYAGSAFICPEFRYLLNGVEFAD------SFNFNPHKWLLVNFDCSAMWVKKRTDLTEAFNMDPV 331

  Fly   351 NLRKFAEPRGEIVIDSRFNSISLAITLATLAGDQMKSITKLGSMLHMRGVSGARVIVPGQNKTID 415
            .||...:..| ::.|.|...|.|        |.:.:|: |:..:..|.||.|.:..:....|.  
  Rat   332 YLRHSHQDSG-LITDYRHWQIPL--------GRRFRSL-KMWFVFRMYGVKGLQAYIRKHVKL-- 384

  Fly   416 GHEF 419
            .|||
  Rat   385 SHEF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 46/199 (23%)
DdcNP_001257781.1 Pyridoxal_deC 35..414 CDD:278699 46/199 (23%)
2 X approximate tandem repeats 58..178
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.