DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and hdl-1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_502265.2 Gene:hdl-1 / 178129 WormBaseID:WBGene00001839 Length:905 Species:Caenorhabditis elegans


Alignment Length:339 Identity:63/339 - (18%)
Similarity:116/339 - (34%) Gaps:93/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GSTLLARLTNALILDLIRGIGLPSCAGCFLVPMCTGMTLTLCLQSLRKRRPGAR-YVLWSRIDQK 173
            |.||.|    |::.|:.||: :|     |.|....|.:.......|.:..|..| :..|..:|  
 Worm   564 GDTLHA----AIMADIERGL-IP-----FFVGANFGTSGPCSFDHLHELGPVCREHGTWLHVD-- 616

  Fly   174 SCFKAITATGLVPVVIPCLIKGESLNTNVDLFREKIKSLGVDSILCLYTTTSCFAPRNSDDIAEV 238
               .|...|.|:...|..|::|.....:......|: .:.|..:.||:.       |:...:...
 Worm   617 ---AAYAGTALICPEIRGLMRGIDWADSFCTTPSKL-IIAVCDVCCLWV-------RDRHKLQHA 670

  Fly   239 SKLSKQWQIPH---------------LVNNAYGLQAKEIVNQLECANRVGRIDYFVQSSDKNLLV 288
            | |.....:|.               .:..::|::  .:.||:....|:|::  ..:...|:|..
 Worm   671 S-LENHPDLPFKGLPTSQRVGALKIWFMIRSFGVE--NLQNQIREHIRLGQV--MTKILQKDLRF 730

  Fly   289 PVGSAIVAS-----------FNESVLHDVASTYAGRAS---------------------GSQSLD 321
            .|.:.:|..           ||:::|:....|  |..|                     ..:.||
 Worm   731 EVCNKVVMGLICFRAKSNDMFNKALLYRCNET--GNVSLASCVLQNKFVIRMCINSPKCSEEDLD 793

  Fly   322 VLMTLLSLGRNGFRLL--FDQRGENFNY--LRENLRKFAEPRGEIVIDSRFNSISLAITLATLAG 382
            ....|:.   |.:.:|  |..|.|..|.  |...:|..|:......:..||..::..        
 Worm   794 SAYKLIC---NEYDILKPFQYRIEVMNQAELETFIRDPAKIHSSAEVSRRFPVVNPL-------- 847

  Fly   383 DQMKSITKLGSMLH 396
            :..:|:.::.|.:|
 Worm   848 EPCRSLAQISSQMH 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 63/339 (19%)
hdl-1NP_502265.2 Pyridoxal_deC 377..746 CDD:278699 40/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.