DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and spl-1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_499913.1 Gene:spl-1 / 176857 WormBaseID:WBGene00004981 Length:552 Species:Caenorhabditis elegans


Alignment Length:230 Identity:48/230 - (20%)
Similarity:82/230 - (35%) Gaps:72/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PVVIPCLIKGESLNTNVDLFREKIKSLGVDS----------------ILCLYTTTSCFAPRNSDD 234
            ||::.|.....:.:....|...:::.:.|||                :..|..:...|.....|.
 Worm   228 PVILACKTAHAAFDKAAHLCGMRLRHVPVDSDNRVDLKEMERLIDSNVCMLVGSAPNFPSGTIDP 292

  Fly   235 IAEVSKLSKQWQIPHLVNNAYGLQAKEIVNQLECANRVGRIDYFVQSSDKNLLVPV--------- 290
            |.|::||.|::.||..|:...|                |.:..|:  :|...|:||         
 Worm   293 IPEIAKLGKKYGIPVHVDACLG----------------GFMIPFM--NDAGYLIPVFDFRNPGVT 339

  Fly   291 --------------GSAIVASFNESVLH----DVAS---------TYAGRASGSQSLDVLMTLLS 328
                          ||:||...::.:.|    .||.         |.||..:|:.:.....||||
 Worm   340 SISCDTHKYGCTPKGSSIVMYRSKELHHFQYFSVADWCGGIYATPTIAGSRAGANTAVAWATLLS 404

  Fly   329 LGRNGFRLLFDQRGENFNYLRENLR--KFAEPRGE 361
            .||:.:.....|..::...|.|.:.  |:.:|.|:
 Worm   405 FGRDEYVRRCAQIVKHTRMLAEKIEKIKWIKPYGK 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 48/230 (21%)
spl-1NP_499913.1 DOPA_deC_like 138..501 CDD:99743 48/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.