DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and basl-1

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_498210.1 Gene:basl-1 / 175779 WormBaseID:WBGene00015467 Length:509 Species:Caenorhabditis elegans


Alignment Length:253 Identity:52/253 - (20%)
Similarity:89/253 - (35%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RKRRPGARYVLWSRIDQKSCFKAI---TATGLVPVVIPCLIKGESLNTNVDLFREKIKSLGVDSI 217
            ||.|....|:....:|.|....||   .:.|.:|.::                           .
 Worm   242 RKLRSVRGYMENYEMDSKILIDAIEQDRSRGFIPFMV---------------------------A 279

  Fly   218 LCLYTTTSCFAPRNSDDIAEVSKLSKQWQIPHLVNNAYGL--QAKEIVNQLECANRVGRIDYFVQ 280
            |.:.||.:|.|    ||:.::.::.::..:  .::.|:..  :.|.:||.|:          :|.
 Worm   280 LTVGTTATCAA----DDVEKIGQICQKEGL--YLHGAFAFCDEFKYLVNGLK----------YVD 328

  Fly   281 SSDKNLLVPVGSAIVASFNESVLHDVASTYAGRASG-----------SQSLDVLMTLLSLGRNGF 334
            |.:.:|    ..|.:.:|:...|.....|||.|...           |.::|.....:.|||. |
 Worm   329 SYNTDL----HKAGMINFDCCPLWFKNGTYASRYYNVDPVYLAHEYQSSNMDYRHLEVPLGRR-F 388

  Fly   335 RLL---FDQRGENFNYLRENLRKFAEPRGEIVIDSRFNSISLAITLATLAGDQMKSIT 389
            |.|   |..|......:||..||..             |::|..|...:.||:.:..|
 Worm   389 RSLKVWFTMRNMGVEKIREYQRKTV-------------SLALLFTKIIVEGDKFELFT 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 52/253 (21%)
basl-1NP_498210.1 AAT_I 1..508 CDD:302748 52/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.