DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and Gad1

DIOPT Version :10

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_032103.2 Gene:Gad1 / 14415 MGIID:95632 Length:593 Species:Mus musculus


Alignment Length:217 Identity:49/217 - (22%)
Similarity:82/217 - (37%) Gaps:50/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 NQLECANRVGRIDYF-VQSSDKNLLVPVGSAIVASFNESVLHDVASTYA-----GRASGSQSLDV 322
            |.||..:|:  :..| .:.|.||||....|...|.|..:.. |.::.:|     .:....|:...
Mouse    54 NSLEEKSRL--VSAFRERQSSKNLLSCENSDQGARFRRTET-DFSNLFAQDLLPAKNGEEQTAQF 115

  Fly   323 LMTLLSLGRNGFRLLFDQRGENFNY-----LRENLRKF-------AEPRGEIVIDSR-------- 367
            |:.::.:..|..|..||:..:..::     |.|.:..|       .|...:|::|.|        
Mouse   116 LLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR 180

  Fly   368 ------FNSISLAITLATLAGDQMKS----------ITKLGSMLHMRGVSGARVIVPGQNKTIDG 416
                  ||.:|..:.:..|||:.:.|          |..:..::....:...|.||...||  ||
Mouse   181 TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSNK--DG 243

  Fly   417 HEFLDFGSHRSNLQVPYLTVAA 438
            ......|...||:   |..:||
Mouse   244 DGIFSPGGAISNM---YSIMAA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:450240 49/217 (23%)
Gad1NP_032103.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Pyridoxal_deC 143..517 CDD:395219 28/125 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.