DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecS and Ddc

DIOPT Version :9

Sequence 1:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001177377.1 Gene:Ddc / 13195 MGIID:94876 Length:480 Species:Mus musculus


Alignment Length:249 Identity:49/249 - (19%)
Similarity:85/249 - (34%) Gaps:101/249 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 ATGLVPVVIPCLIKGESLNTNVDLFREKIKSLGVDSILCLYTTTSCFAPRNSDDIAEVSKLSKQW 245
            |.||:|..:                   :.:||         ||||.   :.|::.||..:..|.
Mouse   231 AAGLIPFFV-------------------VATLG---------TTSCC---SFDNLLEVGPICNQE 264

  Fly   246 QIPHLVNNAYGLQA------KEIVNQLECANRVGRIDYFVQSSDKNLLVPVGSAIVASFNESVLH 304
            .:...::.||...|      :.::|.:|.|      |.|..:..|.|||        :|      
Mouse   265 GVWLHIDAAYAGSAFICPEFRYLLNGVEFA------DSFNFNPHKWLLV--------NF------ 309

  Fly   305 DVASTYAGR---ASGSQSLDVLMTLLSLGRNGFRLLFDQRGENFNYLRENLRKFAEPRGEIVIDS 366
            |.::.:..|   .:|:.::|.:....|...:||  :.|.|                 ..:|.:..
Mouse   310 DCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGF--ITDYR-----------------HWQIPLGR 355

  Fly   367 RFNSISLAITLATLAGDQMKSITKLGSMLHMRGVSGARVIVPGQNKTID-GHEF 419
            ||.|:                  |:..:..|.||.|.:..:   .|.:: .|||
Mouse   356 RFRSL------------------KMWFVFRMYGVKGLQAYI---RKHVELSHEF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecSNP_649556.3 AAT_I 12..457 CDD:302748 49/249 (20%)
DdcNP_001177377.1 Pyridoxal_deC 35..414 CDD:395219 49/249 (20%)
2 X approximate tandem repeats 58..178
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.