DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kra and C37C3.2

DIOPT Version :9

Sequence 1:NP_524238.1 Gene:kra / 40680 FlyBaseID:FBgn0250753 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001370553.1 Gene:C37C3.2 / 179165 WormBaseID:WBGene00016496 Length:436 Species:Caenorhabditis elegans


Alignment Length:210 Identity:42/210 - (20%)
Similarity:88/210 - (41%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 PNKRTEEYFKQVFLDKELNEIVKLHKAQASQEAKRELQQALI------DDINDEKPYNEITSDIK 280
            ||........::.|||:|         :.|:|.:.::.....      |.|:|.|.    .:.::
 Worm   198 PNGMLSAGMGKLVLDKDL---------EKSEEQRLDMLHTFFLKAKEEDRISDAKG----QTALR 249

  Fly   281 DFSQRTNIPDHEIIVIIWSTIMSLGEWNKKEELVTDQAVRHLKNYCPLLQAFASTD-RSELALIL 344
            |.::|..:.....::        |......|:::||:.:...:|   ||..|...| :::..|:.
 Worm   250 DEAERLELKQKASLL--------LANVFLDEKVITDKQISKHRN---LLLRFTLNDKKAQRYLLG 303

  Fly   345 KVQEFCYEN-MNFMKAFQKIILLFYKTEVLSEEIILRWYKEGHSNKGKMHF----LEQMRKFVEW 404
            .|::..::: ...:.....||...|..:|..|:.::.|.::..|......|    :|..:..:.|
 Worm   304 GVEQVIHKHEAELLSKSAHIIKSLYDEDVCEEDSLISWGEKPSSKYVSKSFAKKIIENSQPVLNW 368

  Fly   405 LQSAEEESESEDEQK 419
            |:.||||:|.|.:.:
 Worm   369 LKEAEEETEEESDDE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kraNP_524238.1 W2_eIF5C_like 218..406 CDD:211398 35/195 (18%)
C37C3.2NP_001370553.1 eIF-5_eIF-2B 9..126 CDD:396445
W2_eIF5 216..370 CDD:211399 29/168 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.