DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH2D1A and Synj

DIOPT Version :9

Sequence 1:NP_002342.1 Gene:SH2D1A / 4068 HGNCID:10820 Length:128 Species:Homo sapiens
Sequence 2:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster


Alignment Length:121 Identity:30/121 - (24%)
Similarity:48/121 - (39%) Gaps:23/121 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    11 ISRETGEKLLLATGLDGSYLLRDSES-------VPGVYCLCVLYHGYIYTYRVSQTETGSWSAET 68
            :.|:...|:..|.|..|:..|...||       |.|  |:.:...|.|..:|::||...|.. ..
  Fly    49 VIRKQYTKVCDAYGCLGALQLNAGESTVLFLVLVTG--CVSMGKIGDIEIFRITQTTFVSLQ-NA 110

Human    69 APGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVC 124
            ||...|  ..:::.|:::      |..    |.....:|| |..|.:..|.|..:|
  Fly   111 APNEDK--ISEVRKLLNS------GTF----YFAHTNASA-SASGASSYRFDITLC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH2D1ANP_002342.1 SH2_SAP1a 2..104 CDD:198263 23/99 (23%)
Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890 67..92 4/24 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..128 7/19 (37%)
SynjNP_001246454.1 Syja_N 61..353 CDD:280532 27/109 (25%)
INPP5c_Synj 538..863 CDD:197323
DUF1866 862..1008 CDD:286093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.