DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH2D1A and inpp-5K

DIOPT Version :10

Sequence 1:NP_002342.1 Gene:SH2D1A / 4068 HGNCID:10820 Length:128 Species:Homo sapiens
Sequence 2:NP_498783.1 Gene:inpp-5K / 183643 WormBaseID:WBGene00086546 Length:398 Species:Caenorhabditis elegans


Alignment Length:136 Identity:28/136 - (20%)
Similarity:46/136 - (33%) Gaps:51/136 - (37%)


- Green bases have known domain annotations that are detailed below.


Human     2 DAVAVY---HGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGS 63
            |:.||:   :|.|...|.   |:|.||..   :..||::.|.          :.|:   .|...|
 Worm    18 DSEAVHNMLNGMIDDHTH---LVAIGLQE---VAHSETIGGA----------VLTW---ATTIAS 63

Human    64 WS---------AETAPGVH-------KRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQ 112
            |.         |:|....:       |:...:||.:...||:...|             .....:
 Worm    64 WMNTNGRMVLLAKTFQATNQVLIFGRKQLIGQIKRIDYRFQRNTMG-------------GLTGHK 115

Human   113 GTTGIR 118
            |:.|:|
 Worm   116 GSIGVR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH2D1ANP_002342.1 SH2_SAP1a 2..104 CDD:198263 25/120 (21%)
Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890 67..92 6/31 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..128 3/13 (23%)
inpp-5KNP_498783.1 IPPc 1..284 CDD:214525 28/136 (21%)
SKICH 293..394 CDD:465482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.