DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH2D1A and sac-2

DIOPT Version :10

Sequence 1:NP_002342.1 Gene:SH2D1A / 4068 HGNCID:10820 Length:128 Species:Homo sapiens
Sequence 2:NP_001252206.1 Gene:sac-2 / 173236 WormBaseID:WBGene00012353 Length:783 Species:Caenorhabditis elegans


Alignment Length:53 Identity:17/53 - (32%)
Similarity:26/53 - (49%) Gaps:8/53 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    65 SAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGI 117
            |||::..:     |:|:.:|:...|.| |.||..|  :...|..:..|||..|
 Worm    80 SAESSHSI-----RRIERVIAINVKSD-GSVIKSQ--ITPGSGTKLKQGTEKI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH2D1ANP_002342.1 SH2_SAP1a 2..104 CDD:198263 12/38 (32%)
Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890 67..92 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..128 5/12 (42%)
sac-2NP_001252206.1 COG5329 25..520 CDD:227637 17/53 (32%)
hSac2 549..>615 CDD:463592
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.