DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha26 and ATP6V1E2

DIOPT Version :9

Sequence 1:NP_001287182.1 Gene:Vha26 / 40679 FlyBaseID:FBgn0283535 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001304992.1 Gene:ATP6V1E2 / 90423 HGNCID:18125 Length:226 Species:Homo sapiens


Alignment Length:224 Identity:137/224 - (61%)
Similarity:173/224 - (77%) Gaps:0/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVE 65
            |||||.||:||||||||||||||||||||||||||||||||||||||.|||||||||||||||:|
Human     1 MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIE 65

  Fly    66 LQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEP 130
            .||||..|.|.||||||||:.|.|.:|.:|.:|:.||..:.::...|:.:|.||::|||.:::||
Human    66 QQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEP 130

  Fly   131 KVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNT 195
            .:|:|||..|:.||...:..|:.:|.....::||:.||::.:|:.:..||||:.:.|.||||.||
Human   131 VMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNT 195

  Fly   196 LESRLDLISQQLVPEIRNALFGRNVNRKF 224
            |||||||.::|.:||||.||||.|.||||
Human   196 LESRLDLSAKQKMPEIRMALFGANTNRKF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha26NP_001287182.1 NtpE 9..217 CDD:224308 123/207 (59%)
vATP-synt_E 18..216 CDD:280215 114/197 (58%)
ATP6V1E2NP_001304992.1 vATP-synt_E 18..216 CDD:366869 114/197 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148160
Domainoid 1 1.000 245 1.000 Domainoid score I2185
eggNOG 1 0.900 - - E1_COG1390
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I2791
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53684
OrthoDB 1 1.010 - - D1489718at2759
OrthoFinder 1 1.000 - - FOG0002151
OrthoInspector 1 1.000 - - otm41976
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1632
SonicParanoid 1 1.000 - - X1613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.