DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha26 and VHA-E3

DIOPT Version :9

Sequence 1:NP_001287182.1 Gene:Vha26 / 40679 FlyBaseID:FBgn0283535 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001320763.1 Gene:VHA-E3 / 842725 AraportID:AT1G64200 Length:237 Species:Arabidopsis thaliana


Alignment Length:228 Identity:94/228 - (41%)
Similarity:151/228 - (66%) Gaps:19/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQ 67
            ::|||...||:.|:.||.|||.|||.||...:||||||||.:||:.::.||.:.||||||||:::
plant     1 MNDADASIQIQQMVRFIRQEAEEKANEISISSEEEFNIEKLQLVEAEKKKIRQEYEKKEKQVDVR 65

  Fly    68 KKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTK------NQSEYETVLTKLIVQGLFQ 126
            |||..|..||.:|:|||:.::|.|:::.::|.|:|.:|::      :..:|:.:|..||||.|.:
plant    66 KKIDYSMQLNASRIKVLQAQDDIVNAMKEEAAKQLLKVSQHGFFNHHHHQYKHLLKDLIVQCLLR 130

  Fly   127 IMEPKVILRCREVDVPLVRNVLPAAVEQY--KAQINQNVELFIDEKDFL---------SADTC-G 179
            :.||.|:|||||.|:.:|.::|..|.|:|  ||:::. .|:.:|:..||         .|.:| |
plant   131 LKEPAVLLRCREEDLDIVESMLDDASEEYCKKAKVHA-PEIIVDKDIFLPPAPSDDDPHALSCAG 194

  Fly   180 GVELLALNGRIKVPNTLESRLDLISQQLVPEIR 212
            ||.|.:.:|:|...|||::||::..:..:||::
plant   195 GVVLASRDGKIVCENTLDARLEVAFRNKLPEVK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha26NP_001287182.1 NtpE 9..217 CDD:224308 91/222 (41%)
vATP-synt_E 18..216 CDD:280215 88/213 (41%)
VHA-E3NP_001320763.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 157 1.000 Domainoid score I1309
eggNOG 1 0.900 - - E1_COG1390
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I1513
OMA 1 1.010 - - QHG53684
OrthoDB 1 1.010 - - D1489718at2759
OrthoFinder 1 1.000 - - FOG0002151
OrthoInspector 1 1.000 - - otm2891
orthoMCL 1 0.900 - - OOG6_101237
Panther 1 1.100 - - O PTHR45715
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.