DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha26 and Atp6v1e2

DIOPT Version :9

Sequence 1:NP_001287182.1 Gene:Vha26 / 40679 FlyBaseID:FBgn0283535 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001102449.1 Gene:Atp6v1e2 / 366545 RGDID:1311680 Length:226 Species:Rattus norvegicus


Alignment Length:224 Identity:130/224 - (58%)
Similarity:173/224 - (77%) Gaps:0/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVE 65
            |||:|.|||||||||||||||||||||||||||||||||||||||||.||||||:|:||||||:|
  Rat     1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIE 65

  Fly    66 LQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEP 130
            .|||||.|.|.||||:.||:.|::.:..:|.:|:.||..:..::..|:.:|.||::|.|.:::||
  Rat    66 QQKKIQLSTMRNQARITVLRARDNLILELLKEAKMRLSRIVSDEEFYQDLLDKLVLQALLRLLEP 130

  Fly   131 KVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNT 195
            .:|:||||.|..||::.|..|:.||.....:::|:.||:.::||::..||||:.:.:.:|||.||
  Rat   131 VMIVRCREQDFYLVQSALLRAIPQYMMLCQKHLEVQIDQTEYLSSNAAGGVEVYSSDRKIKVSNT 195

  Fly   196 LESRLDLISQQLVPEIRNALFGRNVNRKF 224
            |||||:|.:.|.:||||..|||.|.||||
  Rat   196 LESRLNLAALQNMPEIRRTLFGDNSNRKF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha26NP_001287182.1 NtpE 9..217 CDD:224308 117/207 (57%)
vATP-synt_E 18..216 CDD:280215 107/197 (54%)
Atp6v1e2NP_001102449.1 NtpE 9..217 CDD:224308 117/207 (57%)
vATP-synt_E 18..216 CDD:280215 107/197 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342031
Domainoid 1 1.000 243 1.000 Domainoid score I2140
eggNOG 1 0.900 - - E1_COG1390
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 289 1.000 Inparanoid score I2725
OMA 1 1.010 - - QHG53684
OrthoDB 1 1.010 - - D1489718at2759
OrthoFinder 1 1.000 - - FOG0002151
OrthoInspector 1 1.000 - - otm46116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45715
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1613
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.