DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha26 and clec-79

DIOPT Version :9

Sequence 1:NP_001287182.1 Gene:Vha26 / 40679 FlyBaseID:FBgn0283535 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_500450.1 Gene:clec-79 / 177154 WormBaseID:WBGene00018548 Length:575 Species:Caenorhabditis elegans


Alignment Length:118 Identity:26/118 - (22%)
Similarity:39/118 - (33%) Gaps:39/118 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QSSNMLNQARLKVLK----VREDH--------------------------VSSVLDDARKRLGEV 105
            :|||.|:..: ||||    .:|.|                          ||.:....|.|....
 Worm   267 RSSNQLDVCK-KVLKPYMYTKESHFFPDPDSMEQLAKLEPETYSLMRSPLVSEIDQSYRNRHNCQ 330

  Fly   106 TKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQ 158
            |.. :.||.||....... |.:...|:      ...|...|::.|::..:|.|
 Worm   331 TPG-AHYEVVLGGKKTAN-FVVEHDKI------KGKPTCDNMMSASISHFKGQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha26NP_001287182.1 NtpE 9..217 CDD:224308 26/118 (22%)
vATP-synt_E 18..216 CDD:280215 26/118 (22%)
clec-79NP_500450.1 CLECT 107..>173 CDD:382969
CLECT 421..563 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1390
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.