DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha26 and clec-79

DIOPT Version :10

Sequence 1:NP_524237.1 Gene:Vha26 / 40679 FlyBaseID:FBgn0283535 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_500450.1 Gene:clec-79 / 177154 WormBaseID:WBGene00018548 Length:575 Species:Caenorhabditis elegans


Alignment Length:118 Identity:26/118 - (22%)
Similarity:39/118 - (33%) Gaps:39/118 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QSSNMLNQARLKVLK----VREDH--------------------------VSSVLDDARKRLGEV 105
            :|||.|:..: ||||    .:|.|                          ||.:....|.|....
 Worm   267 RSSNQLDVCK-KVLKPYMYTKESHFFPDPDSMEQLAKLEPETYSLMRSPLVSEIDQSYRNRHNCQ 330

  Fly   106 TKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQ 158
            |.. :.||.||....... |.:...|:      ...|...|::.|::..:|.|
 Worm   331 TPG-AHYEVVLGGKKTAN-FVVEHDKI------KGKPTCDNMMSASISHFKGQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha26NP_524237.1 vATP-synt_E 18..216 CDD:396537 26/118 (22%)
clec-79NP_500450.1 CLECT 107..>173 CDD:470576
CLECT 421..563 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.