DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha26 and clec-73

DIOPT Version :10

Sequence 1:NP_524237.1 Gene:Vha26 / 40679 FlyBaseID:FBgn0283535 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_500445.1 Gene:clec-73 / 177153 WormBaseID:WBGene00021579 Length:577 Species:Caenorhabditis elegans


Alignment Length:206 Identity:34/206 - (16%)
Similarity:67/206 - (32%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KAEEIDA--------KAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLK 82
            |.:::|.        ....:|::.:..::            |...:||||...|....:..|.:.
 Worm   186 KTDKVDGDNLALSFYDVHPDFSVPQNAMI------------KINGKVELQALCQYKPAITPAEIN 238

  Fly    83 VLKVREDHV----SSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLF--------------QI-- 127
            .:..|...:    ..|.|....|........|....|..|::...::              |:  
 Worm   239 YMGRRYSEIYYPTVPVKDGIIVRSASSYTRSSNQSDVCKKVLKPYMYSKESQFFPDPDSMEQLAK 303

  Fly   128 MEPKVILRCREVDVPLVRNVLPAAVEQYK------AQINQNVEL----------FIDEKDFLSAD 176
            :||:.....|.   |||.|    :||:|:      |..|.:.|:          .::|.......
 Worm   304 LEPEAYSLMRS---PLVSN----SVERYRTNRYCQAPSNPHYEVVLGGKKTANFVVEENKIKGKP 361

  Fly   177 TCGGVELLALN 187
            ||..:..::::
 Worm   362 TCDNMMSVSIS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha26NP_524237.1 vATP-synt_E 18..216 CDD:396537 34/206 (17%)
clec-73NP_500445.1 CLECT 108..>174 CDD:470576
CLECT <445..563 CDD:470576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.