powered by:
Protein Alignment Vha26 and clec-123
DIOPT Version :9
Sequence 1: | NP_001287182.1 |
Gene: | Vha26 / 40679 |
FlyBaseID: | FBgn0283535 |
Length: | 226 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494450.1 |
Gene: | clec-123 / 173658 |
WormBaseID: | WBGene00021288 |
Length: | 578 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 12/62 - (19%) |
Similarity: | 29/62 - (46%) |
Gaps: | 3/62 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 LKIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEY 112
::...:|.:.:..:|:.||:..|..:.:.. ..:..:| |..:|.:.|.:....|::..||
Worm 259 IRSASHYTRSKTNLEVCKKVLKSFYITEIE-PFMPTQE--VMELLTNNRPKSSHFTRSGGEY 317
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1390 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.