DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mapk4 and rl

DIOPT Version :9

Sequence 1:NP_998638.1 Gene:mapk4 / 406782 ZFINID:ZDB-GENE-040426-2835 Length:674 Species:Danio rerio
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:346 Identity:146/346 - (42%)
Similarity:201/346 - (58%) Gaps:29/346 - (8%)


- Green bases have known domain annotations that are detailed below.


Zfish    13 FDLGAQYQDLRPLGTGASGLVLSALDRRSGLRVAVKKL-VMRDAVSVKHALREVKITRRLQHENV 76
            |::|.:|..|..:|.||.|:|:||.|..:..|||:||: ........:..|||:.|..|.:|||:
  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENI 96

Zfish    77 VRVYDVLGSSGHPLPRDLTHVAAIYIVQECMETDLARLLEQGPLPAEHATLLFYQLLRGLKFIHS 141
            :.:.|:|........||      :||||..|||||.:||:...|..:|.....||:|||||:|||
  Fly    97 IDIRDILRVDSIDQMRD------VYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHS 155

Zfish   142 ANVLHRDLKPANIFINTEQMLLKIGDFGLARIVDPHYSHKGYLSEGMVTKWYRSPRLLLSPNNYT 206
            ||||||||||:|:.:| :...|||.|||||||.||.:.|.|:|:|.:.|:|||:|.::|:...||
  Fly   156 ANVLHRDLKPSNLLLN-KTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYT 219

Zfish   207 KAIDMWAAGCILAEMLTGRMLFAGAHELEQMQLIL--------DTVPVIREEDRQELLRVMPSLV 263
            |:||:|:.||||||||:.|.:|.|.|.|:|:..||        |.:..|..|..:..|..:|...
  Fly   220 KSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKP 284

Zfish   264 GHGWQIRRSFRDLMPEVEDKAIDFLESILTFNPMDRLTAEAALCQPFLQRYSCPQDEPVSLQPFR 328
            ...|      ..|.|..:..|:|.|..:|||||..|:..|.||..|:|::|..|.||||:..|||
  Fly   285 NVPW------AKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFR 343

Zfish   329 IEDELED-------SLVTEST 342
            |..|.:|       ||:.|.|
  Fly   344 INMENDDISRDALKSLIFEET 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mapk4NP_998638.1 STKc_MAPK4_6 13..352 CDD:143359 146/346 (42%)
S_TKc 19..311 CDD:214567 127/300 (42%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 146/346 (42%)
S_TKc 38..326 CDD:214567 127/300 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.