DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment noi and pcp1

DIOPT Version :9

Sequence 1:NP_477114.1 Gene:noi / 40678 FlyBaseID:FBgn0014366 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_594115.1 Gene:pcp1 / 2541455 PomBaseID:SPAC6G9.06c Length:1208 Species:Schizosaccharomyces pombe


Alignment Length:376 Identity:81/376 - (21%)
Similarity:146/376 - (38%) Gaps:84/376 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METLLEQQRRLHEERERLVKLMVDEHATKKPGEKERIHSEHRLKYLMELHHNSTSQLRDLYEDKD 65
            :|:|..|.|.:.||:..| :|:..:::.|...| ..|..:...|.|..|...:::.|.::::.::
pombe   465 IESLRTQNREIDEEKNHL-RLLASKNSDKALAE-TNIRLQEVTKELETLRMKNSNDLNEIHDLRE 527

  Fly    66 NERKAEIAALSGPNEFNEFYARLKQIKQFYKSHPAEVSVPLSVEFDEMIRVYNNP--------DD 122
            ......:...|...|.:..   :.:::|..||:...||     |.:..|..|.|.        ::
pombe   528 ENEGLTLKIDSITKEKDRL---INELEQRIKSYEVNVS-----ELNGTIDEYRNKLKDKEETYNE 584

  Fly   123 MSALVEFTDEEGGGRYLDLNECYELYLNLRSVEKLDYITYLMSFDHVFDIPRE-----RKNRE-Y 181
            :....::.|.       ||...:|....|:..|| :..:.|...:.|....||     .|.|| .
pombe   585 VMNAFQYKDN-------DLRRFHESINKLQDREK-ELTSNLEKKNLVISSLRETVAMLEKERESI 641

  Fly   182 RIYI-------------ETLNDYLHHFILRIQPLLDLEGELLKVELDFQRQWLMGTFPGFSIKET 233
            :.|:             |.|||.:.  :|:.| |.|::.||                 ..|.:|.
pombe   642 KKYLSGNAKDLDNTNLMEILNDKIS--VLQRQ-LTDVKDEL-----------------DVSEEER 686

  Fly   234 ESALANTGAHLDLS--AFSSWEELASLGLDRLKSALVALGLKCGGTLEERAQRLFSTKGKSTLDP 296
            |.|:. .|..|..|  ..|:.::...|....||:.|:    .....|:.|.:.|      |.|..
pombe   687 EEAIV-AGQKLSASFELMSNEKQALELKYSSLKNELI----NAQNLLDRREEEL------SELSK 740

  Fly   297 ALMAKKPSAKTASAQSREHERHKEIAQLEALLYKYADLLSEQRAATKENVQ 347
            .|..::   |..|..:.:.|::|||..|.:.|   ||.|::.|....:.::
pombe   741 KLFEER---KIRSGSNDDIEKNKEINVLNSEL---ADKLAQIRHLESDKME 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noiNP_477114.1 PRP9 2..503 CDD:227515 81/375 (22%)
SF3a60_bindingd 74..99 CDD:288924 5/24 (21%)
SF3A3 128..203 CDD:293442 21/93 (23%)
Telomere_Sde2_2 244..301 CDD:290036 13/58 (22%)
DUF3449 324..500 CDD:288759 6/24 (25%)
pcp1NP_594115.1 Smc 150..1010 CDD:224117 81/376 (22%)
Cnn_1N 152..219 CDD:285263
V_ATPase_I 545..>636 CDD:279793 20/106 (19%)
DUF342 <928..1017 CDD:302792
PACT_coil_coil 1112..1186 CDD:287467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.