DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and REV7

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_012127.1 Gene:REV7 / 854667 SGDID:S000001401 Length:245 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:34/185 - (18%)
Similarity:74/185 - (40%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MEVLVNHILYVRGIYPSHIFKMK--RMYNSPIYVSI--FPPLNNYLAGVLKSAQELLRRRELQCL 74
            ::..:|.||:.|.:||...|...  :.:|.|.:|.|  .|.|.:|:..::...  |.:...:...
Yeast    13 LKCYINLILFYRNVYPPQSFDYTTYQSFNLPQFVPINRHPALIDYIEELILDV--LSKLTHVYRF 75

  Fly    75 ELIVYQKENEK-LESYKMQLETQRSGLPAEDHLM-------EFEQNMRSVIYKISQRLNQAPKLP 131
            .:.:..|:|:. :|.|.:.. ::...:..:|.::       ||..::.|:|    ..|.:.||:.
Yeast    76 SICIINKKNDLCIEKYVLDF-SELQHVDKDDQIITETEVFDEFRSSLNSLI----MHLEKLPKVN 135

  Fly   132 AGSCQFKVHLHTTQ----------------EAFIRFSHDSQYQEFPWLQTQKTES 170
            ..:..|:..::..:                |.......||.     |::.|:.|:
Yeast   136 DDTITFEAVINAIELELGHKLDRNRRVDSLEEKAEIERDSN-----WVKCQEDEN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
REV7NP_012127.1 HORMA 7..>141 CDD:396743 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104299
Panther 1 1.100 - - LDO PTHR11842
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.