DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and REV7

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_564002.1 Gene:REV7 / 838228 AraportID:AT1G16590 Length:215 Species:Arabidopsis thaliana


Alignment Length:170 Identity:39/170 - (22%)
Similarity:85/170 - (50%) Gaps:15/170 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRRRELQCL 74
            :|:.|||.:..|:|::|.|||..|:.:|..|..:..:..|.|.:|:..........:.:..::.:
plant    16 LVDFMEVAITMIVYLKGFYPSAAFERRRYMNVVVQRARHPELRDYIHSAASGLLPFIEKGLVERV 80

  Fly    75 ELIVYQKENEKLES--YKMQLETQRSGLPAEDHLMEFEQNMRSVIYKISQRLNQAPKLPAGSCQF 137
            .::.:.::|..:|.  :|:.::...:.| .|:..:||.  :||.:.|:|...:....||. :|::
plant    81 AVVFFSEDNVPVERFIFKITIKPSCAAL-VEEGQLEFA--LRSFLIKLSVSKSLVKPLPL-NCRW 141

  Fly   138 KV--------HLHTTQEAFIRFSHDS-QYQEFPWLQTQKT 168
            :|        .:.:::||.:....|: |:|..|.|...|:
plant   142 EVTAYLRSLPQVGSSKEAELWIPTDTKQWQNPPVLTPVKS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
REV7NP_564002.1 HORMA 19..>111 CDD:280464 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2656
OMA 1 1.010 - - QHG59766
OrthoDB 1 1.010 - - D1630737at2759
OrthoFinder 1 1.000 - - FOG0006157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104299
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.