DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and Mad2l2

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001292349.1 Gene:Mad2l2 / 71890 MGIID:1919140 Length:211 Species:Mus musculus


Alignment Length:195 Identity:57/195 - (29%)
Similarity:98/195 - (50%) Gaps:6/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EIKADIIVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRR 68
            ::.||::.|.:||.|:.|||||.:||..||:.::.||.|:.:|..|.||.|:...|...:.||.:
Mouse    13 QVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEK 77

  Fly    69 RELQCLELIVYQKENEKLESYKMQLETQRS--GLPAEDHLMEFEQNMRSVIYKISQRLNQAPKLP 131
            .:::.:.:::..||:..:|.:..:: ||..  .:.::..|...||.:|:.|.|||.........|
Mouse    78 NDVEKVVVVILDKEHRPVEKFVFEI-TQPPLLSINSDSLLSHVEQLLRAFILKISVCDAVLDHNP 141

  Fly   132 AGSCQFKVHLHTTQEAFIRFSHDSQYQEFPWLQTQKTESQATGRTVYLLPLARVDDLGLKMDVLI 196
            .| |.|.|.:||.:.|..........::|||:...  |.........|:||..:....|||.:.:
Mouse   142 PG-CTFTVLVHTREAATRNMEKIQVIKDFPWILAD--EQDVHMHDPRLIPLKTMTSDILKMQLYV 203

  Fly   197  196
            Mouse   204  203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
Mad2l2NP_001292349.1 HORMA 18..>103 CDD:396743 27/85 (32%)
Mediates interaction with REV1 and REV3L and homodimerization. /evidence=ECO:0000250 21..155 44/135 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835673
Domainoid 1 1.000 62 1.000 Domainoid score I10351
eggNOG 1 0.900 - - E1_KOG3186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5140
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006157
OrthoInspector 1 1.000 - - oto95175
orthoMCL 1 0.900 - - OOG6_104299
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1083
SonicParanoid 1 1.000 - - X5884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.