DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and mad2l2

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001017595.1 Gene:mad2l2 / 550258 ZFINID:ZDB-GENE-050417-61 Length:211 Species:Danio rerio


Alignment Length:194 Identity:58/194 - (29%)
Similarity:99/194 - (51%) Gaps:4/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EIKADIIVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRR 68
            ::.|||:.|.:||.::.|||||.||||.||:.::.||.|:.:|..|.||.|:...|...:.|:.:
Zfish    13 QVVADILCEFLEVAIHLILYVRDIYPSGIFQKRQKYNVPVQMSCHPQLNQYIQDTLHCVKPLIEK 77

  Fly    69 RELQCLELIVYQKENEKLESYKMQL-ETQRSGLPAEDHLMEFEQNMRSVIYKISQRLNQAPKLPA 132
            .|.:.:.:::..||:..:|.:..:: :.....:.:|..|...||.:|::|.|||.........|.
Zfish    78 NEAEKVVVVIMNKEHHPVERFVFEISQPPLLAISSETLLSHVEQLLRAMILKISVCDAVLDSNPP 142

  Fly   133 GSCQFKVHLHTTQEAFIRFSHDSQYQEFPWLQTQKTESQATGRTVYLLPLARVDDLGLKMDVLI 196
            | |.|.|.:||.:.|..........::|||:...  |.:.......|:||..:....|||.:.:
Zfish   143 G-CTFTVLVHTREAATRNMEKVQVIKDFPWIVAD--EQEVHMEEAKLIPLKTMTSDILKMQLYV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
mad2l2NP_001017595.1 HORMA 21..>103 CDD:280464 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578994
Domainoid 1 1.000 64 1.000 Domainoid score I10174
eggNOG 1 0.900 - - E1_KOG3186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5058
OMA 1 1.010 - - QHG59766
OrthoDB 1 1.010 - - D1630737at2759
OrthoFinder 1 1.000 - - FOG0006157
OrthoInspector 1 1.000 - - oto38832
orthoMCL 1 0.900 - - OOG6_104299
Panther 1 1.100 - - LDO PTHR11842
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1083
SonicParanoid 1 1.000 - - X5884
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.