DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and mad2

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster


Alignment Length:205 Identity:53/205 - (25%)
Similarity:85/205 - (41%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ADIIVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRRREL 71
            |.||||.::..:|.||:.|||||:..|...:.|...|.:|..|.:..:|..||...:|.|.:..:
  Fly    17 AQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFLQNVLSQTEEWLSKNMI 81

  Fly    72 QCLELIV---YQKENEKLESYKMQLE------TQRSGLPAEDHLMEFEQNMRSVIYKISQRLNQA 127
            ..:.:::   :.||..:...:.||.|      :..:.......|...:..:|.|:.:||..::..
  Fly    82 NKISMVITNAHTKEVLECWDFNMQAELGDGDISDPTKATTTKELSRIQNEIRDVMRQISATVSYL 146

  Fly   128 PKLPAGSCQFKVHLHTTQEAFIRFSHDSQYQEFP--WLQTQKTESQATGRTVYLLPLA---RVDD 187
            |.|.. .|.|.:.:||.|..           |.|  |        ..||..|...|.|   |...
  Fly   147 PLLDC-ICTFDIMIHTLQNT-----------ELPAKW--------DETGAIVIQNPQAVQLRSFS 191

  Fly   188 LGL-KMDVLI 196
            .|| |:|.::
  Fly   192 TGLHKVDTVV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
mad2NP_647991.1 HORMA 13..195 CDD:280464 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11842
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.