DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev7 and mad2

DIOPT Version :9

Sequence 1:NP_649555.1 Gene:Rev7 / 40677 FlyBaseID:FBgn0037345 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_596370.1 Gene:mad2 / 2540589 PomBaseID:SPBC20F10.06 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:34/145 - (23%)
Similarity:74/145 - (51%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVEAMEVLVNHILYVRGIYPSHIFKMKRMYNSPIYVSIFPPLNNYLAGVLKSAQELLRRRELQC 73
            ::.|..|..||.||:.|||||:..||:.|.|...:.||:...:..|:..::....:.:..:::|.
pombe    18 LVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQK 82

  Fly    74 LELIVYQK-ENEKLESYKMQLE-----TQRSGLPAEDHLMEFEQNMRSVIYKISQRLNQAPKLPA 132
            |.|::..| ..|.||.::..:|     .|...:..::..:..::.::::|.:|:..:...|:|..
pombe    83 LILVITSKCSGEDLERWQFNVEMVDTADQFQNIGNKEDELRVQKEIQALIRQITATVTFLPQLEE 147

  Fly   133 GSCQFKVHLHTTQEA 147
             .|.|.|.::..:::
pombe   148 -QCTFNVLVYADKDS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev7NP_649555.1 None
mad2NP_596370.1 HORMA 12..191 CDD:280464 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.